PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf04017g01047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 407aa    MW: 46414.6 Da    PI: 4.7062
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf04017g01047.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box292.2e-091659340
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                              +r C+ + +k++++fC  ++ +lC++C ++ H+       H++v
  Peinf101Scf04017g01047.1 16 ARACDSCLSKRARWFCPADDAFLCQSCDVSVHSAnqlasrHERV 59
                              578*****************************667888888876 PP

2CCT67.92.8e-23350393144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Peinf101Scf04017g01047.1 350 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRT 393
                               9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.8E-121461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.9641461IPR000315B-box-type zinc finger
PfamPF006431.1E-71659IPR000315B-box-type zinc finger
CDDcd000212.63E-111761No hitNo description
PROSITE profilePS5101716.043350392IPR010402CCT domain
PfamPF062037.7E-18350392IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MTSESKTANA IGGKTARACD SCLSKRARWF CPADDAFLCQ SCDVSVHSAN QLASRHERVR  60
LETSSNKSTE TKSDQNCQPA WHQGFTRKAR TPRNGKNKIL IGQRKKDEEN MVPEIGSDNS  120
QDIENEFENE EQLLYRVPIF DPFAAELCIV PNEVLDETTT INDLDILLND DDDLGIPEFL  180
STDMELAEFA ADVESLLGEE FTVVEQEEQS QLSNAAVEDN KAIKIEVEDE EMRAVVACHL  240
DPELDMAREA LSWDFEYEET VEQKVMADTT EFLPSDSTDN KVDAKRRLLL RLNHEAVISA  300
WPNLSSPWTD GVRPHFNPDD CWPDFLETWP GEGGSHQTYG GHVRGGDEGR EARVSRYREK  360
RRTRLFSKKI RYEVRKLNAE KRPRLKGRFV KRTSFSAPGF PYLMNKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1360376RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603861.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLM1A4330.0M1A433_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000143620.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-85B-box type zinc finger protein with CCT domain